PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_120049g0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family MYB
Protein Properties Length: 259aa    MW: 27784.3 Da    PI: 8.5083
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_120049g0010genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.94.2e-171863147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     +g+W++eEd  l + v++ G+++W++I++ ++ gR++k+c++rw + 
   MA_120049g0010 18 KGPWSPEEDAALQHFVQKCGPRNWSLISKAIP-GRSGKSCRLRWCNQ 63
                     79******************************.***********985 PP

2Myb_DNA-binding58.51.5e-1872114347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      ++T+eEd  +++a++q+G++ W+tIar++  gRt++ +k++w++ 
   MA_120049g0010  72 PFTPEEDATIIRAHAQHGNK-WATIARMLS-GRTDNAIKNHWNST 114
                      89******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129426.1441368IPR017930Myb domain
SuperFamilySSF466891.87E-3215111IPR009057Homeodomain-like
SMARTSM007171.7E-151766IPR001005SANT/Myb domain
PfamPF002495.2E-171863IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.5E-251971IPR009057Homeodomain-like
CDDcd001674.15E-152062No hitNo description
SMARTSM007171.3E-1569117IPR001005SANT/Myb domain
PROSITE profilePS5129421.27870119IPR017930Myb domain
PfamPF002491.2E-1572114IPR001005SANT/Myb domain
CDDcd001672.44E-1372115No hitNo description
Gene3DG3DSA:1.10.10.606.2E-2472118IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009723Biological Processresponse to ethylene
GO:0009737Biological Processresponse to abscisic acid
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0010200Biological Processresponse to chitin
GO:0046686Biological Processresponse to cadmium ion
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 259 aa     Download sequence    Send to blast
MASMKGKSSG HDEPDRIKGP WSPEEDAALQ HFVQKCGPRN WSLISKAIPG RSGKSCRLRW  60
CNQLSPQVEH RPFTPEEDAT IIRAHAQHGN KWATIARMLS GRTDNAIKNH WNSTLRRRCQ  120
GGGALVIDDE ITSGADGFRK RSLSEDADAS RKLKKLSLGT TATTTTTEPC SSSASDRSDS  180
SLALGSPPVY RPVPRAAPLS LTNEANLNPS HHEASCSSAD PPTSLCLSLP GTDAPAAPTL  240
PQDLPLPSVP CRCLGLLLP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h89_C6e-391411954159MYB PROTO-ONCOGENE PROTEIN
1h88_C6e-391411954159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00476DAPTransfer from AT4G37260Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1011880.0BT101188.1 Picea glauca clone GQ0071_N15 mRNA sequence.
GenBankEF6010690.0EF601069.1 Picea glauca R2R3-MYB transcription factor MYB6 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002285015.11e-80PREDICTED: transcription factor MYB44-like
SwissprotQ9FDW11e-66MYB44_ARATH; Transcription factor MYB44
TrEMBLA5JYF01e-156A5JYF0_PICGL; R2R3-MYB transcription factor MYB6
STRINGVIT_18s0001g09850.t013e-80(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G50060.13e-65myb domain protein 77